PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G081600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 969aa    MW: 106920 Da    PI: 4.8938
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G081600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.73.6e-204894148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g+WT+eEd++l +av+ + g++Wk+Ia++++ gRt+ qc +rwqk+l
  Sevir.3G081600.1.p 48 KGNWTAEEDDILRKAVETYKGKNWKKIAECFP-GRTDVQCLHRWQKVL 94
                        79******************************.************986 PP

2Myb_DNA-binding612.4e-19100146148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+W++eEde++++ v++lG++ W+tIa+ ++ gR +kqc++rw+++l
  Sevir.3G081600.1.p 100 KGPWSKEEDEIIIQMVNKLGPKKWSTIAQALP-GRIGKQCRERWHNHL 146
                         79******************************.*************97 PP

3Myb_DNA-binding48.12.6e-15152194145
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                         +++WT+eE+ +l++a++ +G++ W+   + ++ gRt++ +k++w+
  Sevir.3G081600.1.p 152 KDAWTQEEEIKLIHAHQTYGNK-WAELTKFLP-GRTDNAIKNHWH 194
                         679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.1794394IPR017930Myb domain
SuperFamilySSF466899.33E-1745101IPR009057Homeodomain-like
SMARTSM007171.1E-184796IPR001005SANT/Myb domain
PfamPF002491.4E-174894IPR001005SANT/Myb domain
CDDcd001675.97E-165094No hitNo description
Gene3DG3DSA:1.10.10.602.1E-2550111IPR009057Homeodomain-like
PROSITE profilePS5129432.0495150IPR017930Myb domain
SuperFamilySSF466894.77E-3197193IPR009057Homeodomain-like
SMARTSM007175.3E-1899148IPR001005SANT/Myb domain
PfamPF002491.3E-17100146IPR001005SANT/Myb domain
CDDcd001671.08E-15102146No hitNo description
Gene3DG3DSA:1.10.10.604.0E-26112153IPR009057Homeodomain-like
SMARTSM007172.8E-14151199IPR001005SANT/Myb domain
PROSITE profilePS5129419.353151201IPR017930Myb domain
PfamPF002491.9E-13152194IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-21154201IPR009057Homeodomain-like
CDDcd001674.41E-11154194No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 969 aa     Download sequence    Send to blast
MTSEKQMASK GTEASAPAVP PDGAVSREPQ KGRLPNGRTT GPARRSSKGN WTAEEDDILR  60
KAVETYKGKN WKKIAECFPG RTDVQCLHRW QKVLNPELVK GPWSKEEDEI IIQMVNKLGP  120
KKWSTIAQAL PGRIGKQCRE RWHNHLNPGI NKDAWTQEEE IKLIHAHQTY GNKWAELTKF  180
LPGRTDNAIK NHWHSSVKKK VDSYRASGLL AQFQGLTPVE YTAGGLNVDS SSAMTNQISE  240
DSGFNVCREV EDSTELSQSS FVKGSCSQEE QTDVALGSHL NVHESLCQDG FTNADNVASA  300
LPDMHHQLST SDMDQGKHLQ EEFSQGMDLD KHLQQEFSQG MDLHLDIDEV PNNFVITDSQ  360
ASSELAGQFQ DTQIMHNLEN DGGSLIPCAV TPCVPILPSV SECEHNINMM SEVGIKNDNC  420
FHPEQWQDIS IQPGVYSSEA ASNFSAPLCP LKTSEPASNF SVPLCPLKTS EPATMMGDHL  480
YYQSSETSLP PSFIFSDVAS NASDVKFETS HCCQDLEIKT CYNASGDPGQ NSYISTEDDR  540
NQTSEPMDSI PEPEKEQLVD LEQSCLEPTA YNGEEALPSQ GDTVLSDKED AGALCYEPPC  600
FSSFEVPFVS CELVTSSDLP EYSPLGIREL MRSSLNFPTP VRLWGSPTRD GSPDAVLKNA  660
AKSFVRTPSI MKKRPRDLSS PSPDIRNEKK SNTEKDCGRS GMSSTRIGKS FMDIPDDFFD  720
LVSPRSAFQK KLKLSQENKE NLDQITDQGE NEGNAKHSAG ILTESSVDNQ NTPKHAPNYE  780
SQRLNTSTKA LSNSKDIIFS RSKPSELLVD KSAPFIDAEY EYVNILADTP GIKRGLESPS  840
AWKSPLFTPF KDAYFMSPAS RSVDALGLVK QINEQSAAAL EEAHEVLASG SPWKRHSKEN  900
SDKENIENVA WKNELATSKS LSKLMAEGRV LDFNECSTPV RKKEDKKMDI GGSASSPVAS  960
SYLRMNVR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C2e-66482016159MYB PROTO-ONCOGENE PROTEIN
1h89_C2e-66482016159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004960645.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960646.10.0PREDICTED: myb-related protein 3R-1
RefseqXP_004960647.10.0PREDICTED: myb-related protein 3R-1
TrEMBLK3Z3V00.0K3Z3V0_SETIT; Uncharacterized protein
STRINGSi021218m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24953879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.21e-102myb domain protein 3r-4